Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METT10D Rabbit Polyclonal Antibody (HRP)

METT10D Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

METT10D

UniProt

Q86W50

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human METT10D

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LNGRVSLNFKDPEAVRALTCTLLREDFGLSIDIPLERLIPTVPLRLNYIH

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_076991

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CHD8 shRNA Plasmid
abx976311-01 150 µg

Mouse CHD8 shRNA Plasmid

Sign In for Pricing
View Details
Mouse CHD8 shRNA Plasmid
abx976311-02 300 µg

Mouse CHD8 shRNA Plasmid

Sign In for Pricing
View Details
Monoclonal Antibody to Interleukin 1 Family, Member 9 (IL1F9)
TRV-0040160-01 20 µL

Monoclonal Antibody to Interleukin 1 Family, Member 9 (IL1F9)

Sign In for Pricing
View Details
Monoclonal Antibody to Interleukin 1 Family, Member 9 (IL1F9)
TRV-0040160-02 100 µL

Monoclonal Antibody to Interleukin 1 Family, Member 9 (IL1F9)

Sign In for Pricing
View Details
Monoclonal Antibody to Interleukin 1 Family, Member 9 (IL1F9)
TRV-0040160-03 200 µL

Monoclonal Antibody to Interleukin 1 Family, Member 9 (IL1F9)

Sign In for Pricing
View Details
Monoclonal Antibody to Interleukin 1 Family, Member 9 (IL1F9)
TRV-0040160-04 1 mL

Monoclonal Antibody to Interleukin 1 Family, Member 9 (IL1F9)

Sign In for Pricing
View Details