Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX29 Rabbit Polyclonal Antibody (Biotin)

SNX29 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RUNDC2A, A-388D4.1

UniProt

Q8TEQ0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SNX29

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AVLQHGLKRSRGLALTAAAIKQAAGFASKTETEPVFWYYVKEVLNKHELQ

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

87kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polystyrene C4 NH₂
HB08016002.5G 5 g

Polystyrene C4 NH₂

Sign In for Pricing
View Details
MMP9 (MMP9/2025R), CF647 conjugate, 0.1mg/mL
BNC472025-500 1x 500 µL

MMP9 (MMP9/2025R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2922), CF594 conjugate, 0.1mg/mL
BNC942922-500 1x 500 µL

Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2922), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AIF1 / Iba1 (Microglia Marker) (AIF1/1909), CF405S conjugate, 0.1mg/mL
BNC041909-100 1x 100 µL

AIF1 / Iba1 (Microglia Marker) (AIF1/1909), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tfr2 Mouse Gene Knockout Kit (CRISPR)
KN517477 1 Kit

Tfr2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
beta 2 Adrenergic Receptor (ADRB2) (NM_000024) Human Over-expression Lysate
LC424968 20 µg

beta 2 Adrenergic Receptor (ADRB2) (NM_000024) Human Over-expression Lysate

Sign In for Pricing
View Details