Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX29 Rabbit Polyclonal Antibody (HRP)

SNX29 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RUNDC2A, A-388D4.1

UniProt

Q8TEQ0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SNX29

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AVLQHGLKRSRGLALTAAAIKQAAGFASKTETEPVFWYYVKEVLNKHELQ

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

87kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHF1 HDR Plasmid (h)
sc-405911-HDR 20 µg

PHF1 HDR Plasmid (h)

Sign In for Pricing
View Details
Ppm1l sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4140103 1.0 µg DNA

Ppm1l sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Mouse Krt39 qPCR Primer Pair
QM61862S 200 Tests

Mouse Krt39 qPCR Primer Pair

Sign In for Pricing
View Details
Phospho-STAT2 (Tyr690) Antibody
MBS7132922-01 0.1 mL

Phospho-STAT2 (Tyr690) Antibody

Sign In for Pricing
View Details
Phospho-STAT2 (Tyr690) Antibody
MBS7132922-02 5x 0.1 mL

Phospho-STAT2 (Tyr690) Antibody

Sign In for Pricing
View Details
Native Rat IgG Protein
MBS1576148-01 0.1 mg

Native Rat IgG Protein

Sign In for Pricing
View Details