Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBED9 Rabbit Polyclonal Antibody (HRP)

ZBED9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SCAND3, ZNF452, Buster4, ZFP38-L, ZNF305P2, dJ1186N24.3

Immunogen

The immunogen is a synthetic peptide directed towards the n terminal region of human ZNF452

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SRQRFRQFCYQETPGPREALSQLRELCRQWLNPEIHTKEQILELLVLEQF

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

89kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_941180

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTLL8 Protein Vector (Mouse) (pPM-C-HA)
48734024 500 ng

TTLL8 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
MID1 (NM_033290) Human Over-expression Lysate
LH13163V 100 µg

MID1 (NM_033290) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-AWAT2 Antibody
CTA1107-01 30 µL

Anti-AWAT2 Antibody

Sign In for Pricing
View Details
Anti-AWAT2 Antibody
CTA1107-02 50 μL

Anti-AWAT2 Antibody

Sign In for Pricing
View Details
Anti-AWAT2 Antibody
CTA1107-03 100 µL

Anti-AWAT2 Antibody

Sign In for Pricing
View Details
Anti-AWAT2 Antibody
CTA1107-04 200 µL

Anti-AWAT2 Antibody

Sign In for Pricing
View Details