Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBED9 Rabbit Polyclonal Antibody (HRP)

ZBED9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SCAND3, ZNF452, Buster4, ZFP38-L, ZNF305P2, dJ1186N24.3

UniProt

Q6R2W3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SCAND3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ETGFSTLSVIKTKHRNSLNIHYPLRVALSSIQPRLDKLTSKKQAHLSH

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

152kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_443155

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FGF7, C-Flag Tag
HA210769-01 20 µg

Human FGF7, C-Flag Tag

Sign In for Pricing
View Details
Human FGF7, C-Flag Tag
HA210769-02 50 µg

Human FGF7, C-Flag Tag

Sign In for Pricing
View Details
Human FGF7, C-Flag Tag
HA210769-03 100 µg

Human FGF7, C-Flag Tag

Sign In for Pricing
View Details
Recombinant Mouse SLAMF7/CD319 Protein (His Tag)
PKSM040807 100 µg

Recombinant Mouse SLAMF7/CD319 Protein (His Tag)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS518865 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
DPP3 (NM_005700) Human Recombinant Protein
TP319658M 100 µg

DPP3 (NM_005700) Human Recombinant Protein

Sign In for Pricing
View Details