Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF483 Rabbit Polyclonal Antibody (HRP)

ZNF483 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZSCAN48, ZKSCAN16

UniProt

Q8TF39

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF483

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EAILRGNAADAESFRQRFRWFCYSEVAGPRKALSQLWELCNQWLRPDIHT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_597721

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAPSS1, CT (A607) (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate Synthethase 1, PAPS Synthethase 1, Sulfurylase Kinase 1, SK1, ATPSK1, PAPSS) (MaxLight 490) discontinued
P3105-59N-ML490 100 µL

PAPSS1, CT (A607) (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate Synthethase 1, PAPS Synthethase 1, Sulfurylase Kinase 1, SK1, ATPSK1, PAPSS) (MaxLight 490) discontinued

Sign In for Pricing
View Details
LY6E (Lymphocyte Antigen 6E, Ly-6E, Retinoic Acid-induced Gene E Protein, RIG-E, Stem Cell Antigen 2, SCA-2, Thymic Shared Antigen 1, TSA-1, 9804, RIGE, SCA2, TSA1)
322682-01 50 µg

LY6E (Lymphocyte Antigen 6E, Ly-6E, Retinoic Acid-induced Gene E Protein, RIG-E, Stem Cell Antigen 2, SCA-2, Thymic Shared Antigen 1, TSA-1, 9804, RIGE, SCA2, TSA1)

Sign In for Pricing
View Details
LY6E (Lymphocyte Antigen 6E, Ly-6E, Retinoic Acid-induced Gene E Protein, RIG-E, Stem Cell Antigen 2, SCA-2, Thymic Shared Antigen 1, TSA-1, 9804, RIGE, SCA2, TSA1)
322682-02 100 µg

LY6E (Lymphocyte Antigen 6E, Ly-6E, Retinoic Acid-induced Gene E Protein, RIG-E, Stem Cell Antigen 2, SCA-2, Thymic Shared Antigen 1, TSA-1, 9804, RIGE, SCA2, TSA1)

Sign In for Pricing
View Details
WNT8A (Biotin)
581624-01 50 µg

WNT8A (Biotin)

Sign In for Pricing
View Details
WNT8A (Biotin)
581624-02 100 µg

WNT8A (Biotin)

Sign In for Pricing
View Details
PerCP/Cy5.5 Anti-human CD133 Antibody *293C3*
113301T1-AAT 100 Tests

PerCP/Cy5.5 Anti-human CD133 Antibody *293C3*

Sign In for Pricing
View Details