Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAMM41 Rabbit Polyclonal Antibody (Biotin)

TAMM41 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RAM41, TAM41, C3orf31

UniProt

Q96BW9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TAMM41

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VVGEDKTKVLNIVKPNIAHFRELYGSILQENPQVVYKSQQGWLEIDKSPE

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_620162

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPB11 Antibody - middle region (ARP66826_P050)
ARP66826_P050 100 µL

HSPB11 Antibody - middle region (ARP66826_P050)

Sign In for Pricing
View Details
Lentiviral mouse Bend4 shRNA (UAS) - Lentiviral mouse Bend4 shRNA (UAS) plasmid
GTR15267427 1 Vial

Lentiviral mouse Bend4 shRNA (UAS) - Lentiviral mouse Bend4 shRNA (UAS) plasmid

Sign In for Pricing
View Details
RPL22 siRNA (Human)
orb1864123-01 15 nmol

RPL22 siRNA (Human)

Sign In for Pricing
View Details
RPL22 siRNA (Human)
orb1864123-02 30 nmol

RPL22 siRNA (Human)

Sign In for Pricing
View Details
Porcine Collagen Type IV, Col IV ELISA Kit
MBS9302167-01 48 Well

Porcine Collagen Type IV, Col IV ELISA Kit

Sign In for Pricing
View Details
Porcine Collagen Type IV, Col IV ELISA Kit
MBS9302167-02 96 Well

Porcine Collagen Type IV, Col IV ELISA Kit

Sign In for Pricing
View Details