Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAMM41 Rabbit Polyclonal Antibody (HRP)

TAMM41 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RAM41, TAM41, C3orf31

UniProt

Q96BW9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TAMM41

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VVGEDKTKVLNIVKPNIAHFRELYGSILQENPQVVYKSQQGWLEIDKSPE

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_620162

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human protein phosphatase 1, regulatory (inhibitor) subunit 12A (PPP1R12A) control (non-phosphor) peptide
AB-23113-CP 100 µg

Human protein phosphatase 1, regulatory (inhibitor) subunit 12A (PPP1R12A) control (non-phosphor) peptide

Sign In for Pricing
View Details
KLRF2, NT (KLRF2, Killer cell lectin-like receptor subfamily F member 2, Activating coreceptor NKp65) (FITC)
MBS6314384-01 0.2 mL

KLRF2, NT (KLRF2, Killer cell lectin-like receptor subfamily F member 2, Activating coreceptor NKp65) (FITC)

Sign In for Pricing
View Details
KLRF2, NT (KLRF2, Killer cell lectin-like receptor subfamily F member 2, Activating coreceptor NKp65) (FITC)
MBS6314384-02 5x 0.2 mL

KLRF2, NT (KLRF2, Killer cell lectin-like receptor subfamily F member 2, Activating coreceptor NKp65) (FITC)

Sign In for Pricing
View Details
POLR1E Antibody - middle region
OAAB12517-400UL 400 µL

POLR1E Antibody - middle region

Sign In for Pricing
View Details
NOS1AP Protein Vector (Mouse) (pPM-C-HA)
32005024 500 ng

NOS1AP Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
MAGED4B (NM_177535) Human Untagged Clone
SC107031 10 µg

MAGED4B (NM_177535) Human Untagged Clone

Sign In for Pricing
View Details