Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C3orf31 Rabbit Polyclonal Antibody (HRP)

C3orf31 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RAM41, TAM41, C3orf31

UniProt

Q96BW9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C3orf31

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QSSWVTFRKILSHFPEELSLAFVYGSGVYRQAGPSSDQKNAMLDFVFTVD

Field of Research

Metabolism Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_620162

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLF10 (Kruppel-like Factor 10, EGRA, TIEG, TIEG1)
368190 100 µg

KLF10 (Kruppel-like Factor 10, EGRA, TIEG, TIEG1)

Sign In for Pricing
View Details
Bovine Isthmin 2 (ISM2) ELISA Kit
MBS9355305-01 48 Well

Bovine Isthmin 2 (ISM2) ELISA Kit

Sign In for Pricing
View Details
Bovine Isthmin 2 (ISM2) ELISA Kit
MBS9355305-02 96 Well

Bovine Isthmin 2 (ISM2) ELISA Kit

Sign In for Pricing
View Details
Bovine Isthmin 2 (ISM2) ELISA Kit
MBS9355305-03 5x 96 Well

Bovine Isthmin 2 (ISM2) ELISA Kit

Sign In for Pricing
View Details
Bovine Isthmin 2 (ISM2) ELISA Kit
MBS9355305-04 10x 96 Well

Bovine Isthmin 2 (ISM2) ELISA Kit

Sign In for Pricing
View Details
Histone H4 Recombinant Rabbit mAb
orb2326636-01 25 µL

Histone H4 Recombinant Rabbit mAb

Sign In for Pricing
View Details