Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C3orf31 Rabbit Polyclonal Antibody (HRP)

C3orf31 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RAM41, TAM41, C3orf31

UniProt

Q96BW9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C3orf31

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LPKTLQQQINHIMDPPGKNRDVEETLFQVAHDPDCGDVVRLGLKKSVIYS

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_620162

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal AKR7A2 Antibody
NBP2-15325 0.1 mL

Rabbit Polyclonal AKR7A2 Antibody

Sign In for Pricing
View Details
Tspyl4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3509105 3x 1.0 µg

Tspyl4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Syntenin 1 Rabbit Polyclonal Antibody (RBITC)
orb1013051 100 µL

Syntenin 1 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
TPCA-1 2mg
A11579-2 2 mg

TPCA-1 2mg

Sign In for Pricing
View Details
TMEM81 Protein Vector (Rat) (pPB-N-His)
PV311827 500 ng

TMEM81 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
RACGAP1 (Rac GTPase-activating Protein 1, Male Germ Eell RacGap, MgcRacGAP, CYK4, HsCYK-4, ID-GAP, KIAA1478, Protein CYK4 Homolog) (FITC)
MBS6149198-01 0.1 mL

RACGAP1 (Rac GTPase-activating Protein 1, Male Germ Eell RacGap, MgcRacGAP, CYK4, HsCYK-4, ID-GAP, KIAA1478, Protein CYK4 Homolog) (FITC)

Sign In for Pricing
View Details