Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zkscan6 Rabbit Polyclonal Antibody (Biotin)

Zkscan6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KOX1, KOX11, Zfp53, Znf18, Zfp535, D11Ertd714, D11Ertd714e, 1700128E15Rik

UniProt

Q810A1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Zkscan6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FSGLRHHEKIHTGEKPYKCPLCEKSFIQRSNFNRHQRVHTGEKPYKCTHC

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080383

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CRABP2 Protein (His Tag)
PKSH031210 100 µg

Recombinant Human CRABP2 Protein (His Tag)

Sign In for Pricing
View Details
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2745), CF640R conjugate, 0.1mg/mL
BNC402745-100 1x 100 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2745), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SAPK4 (MAPK13) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12B8]
TA505855AM 100 µL

SAPK4 (MAPK13) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12B8]

Sign In for Pricing
View Details
MAPK4 (N-term) Rabbit Polyclonal Antibody
AP14039PU-N 400 µL

MAPK4 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tmem39b Mouse Gene Knockout Kit (CRISPR)
KN517860 1 Kit

Tmem39b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cholera Toxin B, CF®647 Conjugate, 100 ug
#00069 1x 100 µg

Cholera Toxin B, CF®647 Conjugate, 100 ug

Sign In for Pricing
View Details