Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXR1 Rabbit Polyclonal Antibody (HRP)

FOXR1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FOXN5, DLNB13

UniProt

Q6PIV2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FOXR1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KKPNPDKDGPDYEPNLWMWVNPNIVYPPGKLEVSGRRKREDLTSTLPSSQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_859072

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kir2.1, CT (Cardiac Inward Rectifier Potassium Channel, HHBIRK1, HHIRK1, Inward Rectifier Potassium Channel 2, Inward Rectifier K (+) Channel Kir2.1, IRK1, IRK-1, hIRK1, LQT7, Potassium Channel Inwardly Rectifying Subfamily J Member 2, KCNJ2, SQT3) (Azide free) (HRP) discontinued
K1856-02C-HRP 200 µL

Kir2.1, CT (Cardiac Inward Rectifier Potassium Channel, HHBIRK1, HHIRK1, Inward Rectifier Potassium Channel 2, Inward Rectifier K (+) Channel Kir2.1, IRK1, IRK-1, hIRK1, LQT7, Potassium Channel Inwardly Rectifying Subfamily J Member 2, KCNJ2, SQT3) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Recombinant Lactobacillus casei GTPase Era (era)
MBS1033719-01 0.02 mg (E-Coli)

Recombinant Lactobacillus casei GTPase Era (era)

Sign In for Pricing
View Details
Recombinant Lactobacillus casei GTPase Era (era)
MBS1033719-02 0.02 mg (Yeast)

Recombinant Lactobacillus casei GTPase Era (era)

Sign In for Pricing
View Details
Recombinant Lactobacillus casei GTPase Era (era)
MBS1033719-03 0.1 mg (E-Coli)

Recombinant Lactobacillus casei GTPase Era (era)

Sign In for Pricing
View Details
Recombinant Lactobacillus casei GTPase Era (era)
MBS1033719-04 0.1 mg (Yeast)

Recombinant Lactobacillus casei GTPase Era (era)

Sign In for Pricing
View Details
Recombinant Lactobacillus casei GTPase Era (era)
MBS1033719-05 0.02 mg (Baculovirus)

Recombinant Lactobacillus casei GTPase Era (era)

Sign In for Pricing
View Details