Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZSCAN22 Rabbit Polyclonal Antibody (HRP)

ZSCAN22 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HKR2, ZNF50

UniProt

P10073

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZSC22

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ESEPSNVTETLMGGVSLGPAFVKACEPEGSSERSGLSGEIWTKSVTQQIH

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

XP_006723255

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD95 / FAS / TNFRSF6 (FAS/3588), CF740 conjugate, 0.1mg/mL
BNC743588-100 1x 100 µL

CD95 / FAS / TNFRSF6 (FAS/3588), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Y Box Binding Protein 1
32-5260-20 20 µg

Recombinant Human Y Box Binding Protein 1

Sign In for Pricing
View Details
Beta-APP42 ELISA Kit (Mouse)
OKEH00816-96W 96 Well

Beta-APP42 ELISA Kit (Mouse)

Sign In for Pricing
View Details
CD59 (1F5, EJ16, EJ30, EL32, G344, MIN1, MIN2, MIN3, MIRL, HRF20, MACIF, MEM43, MIC11, MSK21, 16.3A5, HRF-20, MAC-IP, p18-20) (MaxLight 490)
MBS6410398-01 0.1 mL

CD59 (1F5, EJ16, EJ30, EL32, G344, MIN1, MIN2, MIN3, MIRL, HRF20, MACIF, MEM43, MIC11, MSK21, 16.3A5, HRF-20, MAC-IP, p18-20) (MaxLight 490)

Sign In for Pricing
View Details
CD59 (1F5, EJ16, EJ30, EL32, G344, MIN1, MIN2, MIN3, MIRL, HRF20, MACIF, MEM43, MIC11, MSK21, 16.3A5, HRF-20, MAC-IP, p18-20) (MaxLight 490)
MBS6410398-02 5x 0.1 mL

CD59 (1F5, EJ16, EJ30, EL32, G344, MIN1, MIN2, MIN3, MIRL, HRF20, MACIF, MEM43, MIC11, MSK21, 16.3A5, HRF-20, MAC-IP, p18-20) (MaxLight 490)

Sign In for Pricing
View Details
CXCL10 (1-70) / IP-10 (1-70) (Mouse)
045-38 100 µg

CXCL10 (1-70) / IP-10 (1-70) (Mouse)

Sign In for Pricing
View Details