Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAS7 Rabbit Polyclonal Antibody (Biotin)

GAS7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KIAA0394, MGC1348, MLL/GAS7

UniProt

Q7Z571

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GAS7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IRQHLCQYTQLRHETDMFNQSTVEPVDQLLRKVDPAKDRELWVREHKTGN

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_958839

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CtBP1 (phospho Ser422) Polyclonal Antibody
UB-GEN-1337 100 µL

CtBP1 (phospho Ser422) Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Diacylglycerol O-Acyltransferase 2 (DGAT2) ELISA Kit
abx510248-01 96 Tests

Mouse Diacylglycerol O-Acyltransferase 2 (DGAT2) ELISA Kit

Sign In for Pricing
View Details
Mouse Diacylglycerol O-Acyltransferase 2 (DGAT2) ELISA Kit
abx510248-02 5x 96 Tests

Mouse Diacylglycerol O-Acyltransferase 2 (DGAT2) ELISA Kit

Sign In for Pricing
View Details
Mouse Diacylglycerol O-Acyltransferase 2 (DGAT2) ELISA Kit
abx510248-03 10x 96 Tests

Mouse Diacylglycerol O-Acyltransferase 2 (DGAT2) ELISA Kit

Sign In for Pricing
View Details
Sheep Ultrasensitive thyroid-stimulating hormone ELISA
GTR10455772 96 Well

Sheep Ultrasensitive thyroid-stimulating hormone ELISA

Sign In for Pricing
View Details
Liver Arginase Antibody / ARG1
V5754-20UG 20 µg

Liver Arginase Antibody / ARG1

Sign In for Pricing
View Details