Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAS7 Rabbit Polyclonal Antibody (Biotin)

GAS7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KIAA0394, MGC1348, MLL/GAS7

UniProt

Q7Z571

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GAS7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IRQHLCQYTQLRHETDMFNQSTVEPVDQLLRKVDPAKDRELWVREHKTGN

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_958839

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nek5, CT (Nek5, Serine/threonine-protein kinase Nek5, Never in mitosis A-related kinase 5) (AP) discontinued
038887-AP 200 µL

Nek5, CT (Nek5, Serine/threonine-protein kinase Nek5, Never in mitosis A-related kinase 5) (AP) discontinued

Sign In for Pricing
View Details
2A/2B Dengue Protease Substrate
M41673-01 100 mg

2A/2B Dengue Protease Substrate

Sign In for Pricing
View Details
2A/2B Dengue Protease Substrate
M41673-02 25 mg

2A/2B Dengue Protease Substrate

Sign In for Pricing
View Details
2A/2B Dengue Protease Substrate
M41673-03 50 mg

2A/2B Dengue Protease Substrate

Sign In for Pricing
View Details
2A/2B Dengue Protease Substrate
M41673-04 500 mg

2A/2B Dengue Protease Substrate

Sign In for Pricing
View Details
2A/2B Dengue Protease Substrate
M41673-05 Inquire

2A/2B Dengue Protease Substrate

Sign In for Pricing
View Details