Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAS7 Rabbit Polyclonal Antibody (HRP)

GAS7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KIAA0394, MGC1348, MLL/GAS7

UniProt

Q7Z571

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GAS7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IRQHLCQYTQLRHETDMFNQSTVEPVDQLLRKVDPAKDRELWVREHKTGN

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_958839

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNMA2 Protein Lysate (Rat) with C-HA Tag
37100036 100 µg

PNMA2 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Ttc8 3'UTR Lenti-reporter-Luc Vector
48709084 1.0 µg

Ttc8 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
SNX18 Protein Vector (Mouse) (pPM-C-HA)
PV232476 500 ng

SNX18 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
CPSF4L sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0502406 1.0 µg DNA

CPSF4L sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
TRAV12-3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2444405 3x 1.0 µg

TRAV12-3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Sphingomyelin Phosphodiesterase 3 (SMPD3) Antibody
abx136093-01 60 µL

Sphingomyelin Phosphodiesterase 3 (SMPD3) Antibody

Sign In for Pricing
View Details