Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAS7 Rabbit Polyclonal Antibody (HRP)

GAS7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KIAA0394, MGC1348, MLL/GAS7

UniProt

Q7Z571

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GAS7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IRQHLCQYTQLRHETDMFNQSTVEPVDQLLRKVDPAKDRELWVREHKTGN

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_958839

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fcer1a AAV siRNA Pooled Vector
20375166 1.0 µg

Fcer1a AAV siRNA Pooled Vector

Sign In for Pricing
View Details
TACR3 ELISA Kit (Human) (OKEH02421)
OKEH02421 96 Well

TACR3 ELISA Kit (Human) (OKEH02421)

Sign In for Pricing
View Details
ZNF485 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2709007 1.0 µg DNA

ZNF485 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
CD163L1 AAV siRNA Pooled Vector
15474161 1.0 µg

CD163L1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Cat Alanine Aminotransferase 2 (ALT2) ELISA Kit
MBS9930838 Inquire

Cat Alanine Aminotransferase 2 (ALT2) ELISA Kit

Sign In for Pricing
View Details
Human METRNL knockdown cell line
ABC-KD9192 1 Vial

Human METRNL knockdown cell line

Sign In for Pricing
View Details