Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXN4 Rabbit Polyclonal Antibody (HRP)

FOXN4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ35967

UniProt

Q96NZ1

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FOXN4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HHQVQPQAHLAPDSPAPAQTPPLHALPDLSPSPLPHPAMGRAPVDFINIS

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_998761

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Chloro-4- (chloromethyl) pyridine hydrochloride
HFA68521 2.5 g

3-Chloro-4- (chloromethyl) pyridine hydrochloride

Sign In for Pricing
View Details
ADP Ribosylation Factor 6 (ARF6) (BSA & Azide Free) (HRP)
MBS6266718-01 0.1 mL

ADP Ribosylation Factor 6 (ARF6) (BSA & Azide Free) (HRP)

Sign In for Pricing
View Details
ADP Ribosylation Factor 6 (ARF6) (BSA & Azide Free) (HRP)
MBS6266718-02 5x 0.1 mL

ADP Ribosylation Factor 6 (ARF6) (BSA & Azide Free) (HRP)

Sign In for Pricing
View Details
LOC691231 3'UTR GFP Stable Cell Line
TU262299 1.0 mL

LOC691231 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
KCNJ11, NT (KCNJ11, ATP-sensitive inward rectifier potassium channel 11, IKATP, Inward rectifier K (+) channel Kir6.2, Potassium channel, inwardly rectifying subfamily J member 11) (MaxLight 550) discontinued
037322-ML550 100 µL

KCNJ11, NT (KCNJ11, ATP-sensitive inward rectifier potassium channel 11, IKATP, Inward rectifier K (+) channel Kir6.2, Potassium channel, inwardly rectifying subfamily J member 11) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Recombinant Human Actin-binding protein IPP (IPP)
orb3009695-01 20 µg

Recombinant Human Actin-binding protein IPP (IPP)

Sign In for Pricing
View Details