Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Etv3l Rabbit Polyclonal Antibody (Biotin)

Etv3l Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RGD1562620

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Etv3l

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SGLAFPDWAYKAESSPGSRQIQLWHFILELLQKEEFRHVIAWQQGEYGEF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001094462

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LCN2 Protein Vector (Mouse) (pPB-N-His)
PV196091 500 ng

LCN2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Lentiviral mouse Hhip shRNA (UAS) - Lentiviral mouse Hhip shRNA (UAS, GFP) (100)
GTR15176553 1 Vial

Lentiviral mouse Hhip shRNA (UAS) - Lentiviral mouse Hhip shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Ap1s1 ORF Vector (Rat) (pORF)
ORF063472 1.0 µg DNA

Ap1s1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
ARCN1, ID (ARCN1, COPD, Coatomer subunit delta, Archain, Delta-coat protein) (PE) discontinued
032017-PE 200 µL

ARCN1, ID (ARCN1, COPD, Coatomer subunit delta, Archain, Delta-coat protein) (PE) discontinued

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Adenosylhomocysteinase (SAH1)
MBS1046703-01 0.02 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Adenosylhomocysteinase (SAH1)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Adenosylhomocysteinase (SAH1)
MBS1046703-02 0.02 mg (Yeast)

Recombinant Saccharomyces cerevisiae Adenosylhomocysteinase (SAH1)

Sign In for Pricing
View Details