Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Etv3l Rabbit Polyclonal Antibody (HRP)

Etv3l Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGD1562620

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Etv3l

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SGLAFPDWAYKAESSPGSRQIQLWHFILELLQKEEFRHVIAWQQGEYGEF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001094462

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-D-Trp (Boc) TentaGel® S AC Resin
SAD1128.1G 1 g

Fmoc-D-Trp (Boc) TentaGel® S AC Resin

Sign In for Pricing
View Details
INDO, ID (IDO1, IDO, INDO, Indoleamine 2,3-dioxygenase 1, Indoleamine-pyrrole 2,3-dioxygenase) (MaxLight 650) discontinued
037043-ML650 100 µL

INDO, ID (IDO1, IDO, INDO, Indoleamine 2,3-dioxygenase 1, Indoleamine-pyrrole 2,3-dioxygenase) (MaxLight 650) discontinued

Sign In for Pricing
View Details
CSRP3 Protein Lysate (Mouse) with C-HA Tag
16970035 100 µg

CSRP3 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
TIAM2 Protein Vector (Human) (pPM-C-His)
PV135697 500 ng

TIAM2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
AI467606 Mouse qPCR Primer Pair (NM_178901)
MP204516 200 Reactions

AI467606 Mouse qPCR Primer Pair (NM_178901)

Sign In for Pricing
View Details
Lentiviral mouse Slc28a2 shRNA (UAS) - Lentiviral mouse Slc28a2 shRNA (UAS, GFP) (100)
GTR15265269 1 Vial

Lentiviral mouse Slc28a2 shRNA (UAS) - Lentiviral mouse Slc28a2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details