Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCG_20426 Rabbit Polyclonal Antibody (Biotin)

HCG_20426 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LOC441869, hCG_20426

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human hCG_20426

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MDSQRPEPREEEEEEQELRWMELDSEEALGTRTEGPSVVQGWGHLLQAVW

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

XP_497648

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human pNFkB ELISA Kit
EHP0029 96 Tests

Human pNFkB ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Xeroderma Pigmentosum, Complementation Group D (XPD)
RPU51540-01 50 µg

Recombinant Human Xeroderma Pigmentosum, Complementation Group D (XPD)

Sign In for Pricing
View Details
Recombinant Human Xeroderma Pigmentosum, Complementation Group D (XPD)
RPU51540-02 100 µg

Recombinant Human Xeroderma Pigmentosum, Complementation Group D (XPD)

Sign In for Pricing
View Details
Recombinant Human Xeroderma Pigmentosum, Complementation Group D (XPD)
RPU51540-03 1 mg

Recombinant Human Xeroderma Pigmentosum, Complementation Group D (XPD)

Sign In for Pricing
View Details
Goat Toll Like Receptor 4 (TLR-4) ELISA Kit
MBS269115-01 48 Well

Goat Toll Like Receptor 4 (TLR-4) ELISA Kit

Sign In for Pricing
View Details
Goat Toll Like Receptor 4 (TLR-4) ELISA Kit
MBS269115-02 96 Well

Goat Toll Like Receptor 4 (TLR-4) ELISA Kit

Sign In for Pricing
View Details