Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCG_20426 Rabbit Polyclonal Antibody (FITC)

HCG_20426 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LOC441869, hCG_20426

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human hCG_20426

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MDSQRPEPREEEEEEQELRWMELDSEEALGTRTEGPSVVQGWGHLLQAVW

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

XP_497648

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Brucella Abortus recA Protein (strain 2308) (aa 1-361)
VAng-Lsx5226-50gEcoli 50 µg (E. coli)

Recombinant Brucella Abortus recA Protein (strain 2308) (aa 1-361)

Sign In for Pricing
View Details
Metastasis Associated Protein 2 (MTA2) Antibody
abx235389 100 µg

Metastasis Associated Protein 2 (MTA2) Antibody

Sign In for Pricing
View Details
CD11c Blocking Peptide
MBS9622773-01 1 mg

CD11c Blocking Peptide

Sign In for Pricing
View Details
CD11c Blocking Peptide
MBS9622773-02 5x 1 mg

CD11c Blocking Peptide

Sign In for Pricing
View Details
Thiamine nitrate
S5955-100mg 100 mg

Thiamine nitrate

Sign In for Pricing
View Details
PLV-Tet-miniCMV-IRF2BPL-GFP-nanobody-mCherry-Puro Plasmid
PVT77449 2 µg

PLV-Tet-miniCMV-IRF2BPL-GFP-nanobody-mCherry-Puro Plasmid

Sign In for Pricing
View Details