Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCG_20426 Rabbit Polyclonal Antibody (FITC)

HCG_20426 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LOC441869, hCG_20426

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human hCG_20426

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MDSQRPEPREEEEEEQELRWMELDSEEALGTRTEGPSVVQGWGHLLQAVW

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

XP_497648

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-human Hepatitis A virus cellular receptor 2 polyclonal Antibody
MBS7004309-01 0.05 mg

Rabbit anti-human Hepatitis A virus cellular receptor 2 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human Hepatitis A virus cellular receptor 2 polyclonal Antibody
MBS7004309-02 0.1 mg

Rabbit anti-human Hepatitis A virus cellular receptor 2 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human Hepatitis A virus cellular receptor 2 polyclonal Antibody
MBS7004309-03 5x 0.1 mg

Rabbit anti-human Hepatitis A virus cellular receptor 2 polyclonal Antibody

Sign In for Pricing
View Details
VMN1R104 Adenovirus (Mouse)
49525054 1.0 mL

VMN1R104 Adenovirus (Mouse)

Sign In for Pricing
View Details
Porcine WW domain-containing oxidoreductase (WWOX) ELISA Kit
MBS7214523-01 48 Well

Porcine WW domain-containing oxidoreductase (WWOX) ELISA Kit

Sign In for Pricing
View Details
Porcine WW domain-containing oxidoreductase (WWOX) ELISA Kit
MBS7214523-02 96 Well

Porcine WW domain-containing oxidoreductase (WWOX) ELISA Kit

Sign In for Pricing
View Details