Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCG_20426 Rabbit Polyclonal Antibody (HRP)

HCG_20426 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LOC441869, hCG_20426

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human hCG_20426

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDSQRPEPREEEEEEQELRWMELDSEEALGTRTEGPSVVQGWGHLLQAVW

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

XP_497648

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Otx1 + Otx2 Recombinant Rabbit Monoclonal Antibody [PSH01-62]
HA721705 100 µL

Otx1 + Otx2 Recombinant Rabbit Monoclonal Antibody [PSH01-62]

Sign In for Pricing
View Details
CLEC12A CytoSection
TS413744P5 25 Slides

CLEC12A CytoSection

Sign In for Pricing
View Details
Pet1 Recombinant Rabbit Monoclonal Antibody [PSH07-77]
HA722893 100 µL

Pet1 Recombinant Rabbit Monoclonal Antibody [PSH07-77]

Sign In for Pricing
View Details
UCK (UCK1) Rabbit Polyclonal Antibody
TA368968 100 µL

UCK (UCK1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
P53 (TRP/817), CF405S conjugate, 0.1mg/mL
BNC040817-100 1x 100 µL

P53 (TRP/817), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OR2V2 Human Gene Knockout Kit (CRISPR)
KN423132 1 Kit

OR2V2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details