Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cad Rabbit Polyclonal Antibody (Biotin)

Cad Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

38E.19, anon-WO2004063362.83, Cad, CAD, cd, CG1759, Dmel\CG1759, S67

UniProt

P09085

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Fruit fly

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SVSNNNRTSPSKPPYFDWMKKPAYPAQPQPGKTRTKDKYRVVYTDFQRLE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_599128

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta Crystallin A3 Polyclonal Antibody, PerCP Conjugated
bs-12859R-PerCP 100 µL

Beta Crystallin A3 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
PLXNB1 Rabbit Polyclonal Antibody (Fluoro594)
orb3109898 100 µg

PLXNB1 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Human Desmoyokin (AHNAK) ELISA Kit
RD-AHNAK-Hu-48Tests 48 Tests

Human Desmoyokin (AHNAK) ELISA Kit

Sign In for Pricing
View Details
NPR2 (Natriuretic Peptide Receptor B/Guanylate Cyclase B (atrionatriuretic peptide Receptor B), AMDM, ANPRB, GUC2B, GUCY2B, NPRB, NPRBi) (HRP)
MBS6179721-01 0.1 mL

NPR2 (Natriuretic Peptide Receptor B/Guanylate Cyclase B (atrionatriuretic peptide Receptor B), AMDM, ANPRB, GUC2B, GUCY2B, NPRB, NPRBi) (HRP)

Sign In for Pricing
View Details
NPR2 (Natriuretic Peptide Receptor B/Guanylate Cyclase B (atrionatriuretic peptide Receptor B), AMDM, ANPRB, GUC2B, GUCY2B, NPRB, NPRBi) (HRP)
MBS6179721-02 5x 0.1 mL

NPR2 (Natriuretic Peptide Receptor B/Guanylate Cyclase B (atrionatriuretic peptide Receptor B), AMDM, ANPRB, GUC2B, GUCY2B, NPRB, NPRBi) (HRP)

Sign In for Pricing
View Details
Human LMCD1 Protein Lysate
MBS8414556-01 0.02 mg

Human LMCD1 Protein Lysate

Sign In for Pricing
View Details