Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cad Rabbit Polyclonal Antibody (HRP)

Cad Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

38E.19, anon-WO2004063362.83, Cad, CAD, cd, CG1759, Dmel\CG1759, S67

UniProt

P09085

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Fruit fly

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SVSNNNRTSPSKPPYFDWMKKPAYPAQPQPGKTRTKDKYRVVYTDFQRLE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_599128

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Mrps18c shRNA (UAS) - Lentiviral mouse Mrps18c shRNA (UAS, GFP) plasmid
GTR15203830 1 Vial

Lentiviral mouse Mrps18c shRNA (UAS) - Lentiviral mouse Mrps18c shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
NF-KB p105  polyclonal antibody
BZ17052 50ul

NF-KB p105 polyclonal antibody

Sign In for Pricing
View Details
Human FUN14 domain-containing protein 1 (FUNDC1) ELISA Kit
AE43054HU-01 48 Tests

Human FUN14 domain-containing protein 1 (FUNDC1) ELISA Kit

Sign In for Pricing
View Details
Human FUN14 domain-containing protein 1 (FUNDC1) ELISA Kit
AE43054HU-02 96 Tests

Human FUN14 domain-containing protein 1 (FUNDC1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human TPC11 (His)
orb3067675 50 µg

Recombinant Human TPC11 (His)

Sign In for Pricing
View Details
Human SFMBT2 Protein Lysate
MBS8419324-01 0.02 mg

Human SFMBT2 Protein Lysate

Sign In for Pricing
View Details