Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eve Rabbit Polyclonal Antibody (Biotin)

Eve Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

10.5, 10.9, 14.10, 20.35, CG2328, dm-eve, Dmel\CG2328, E (eve), Eve, EVE, eve2, even, F, l (2) 46Ce, l (2) 46CFg, l (2) 46CFh, l (2) 46CFj, l (2) 46CFp, l (2) 46Cg, V, VI

UniProt

P06602

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Fruit fly

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MHGYRTYNMESHHAHHDASPVDQKPLVVDLLATQYGKPQTPPPSPNECLS

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_523670

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLEKHO1 (Pleckstrin homology domain-containing family O member 1) BioAssayTM ELISA Kit (Human) discontinued
358200-01 48 Tests

PLEKHO1 (Pleckstrin homology domain-containing family O member 1) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
PLEKHO1 (Pleckstrin homology domain-containing family O member 1) BioAssayTM ELISA Kit (Human) discontinued
358200-02 96 Tests

PLEKHO1 (Pleckstrin homology domain-containing family O member 1) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
MB3L1 Antibody
C44689-01 50 µL

MB3L1 Antibody

Sign In for Pricing
View Details
MB3L1 Antibody
C44689-02 100 µL

MB3L1 Antibody

Sign In for Pricing
View Details
EIF2B3 Rabbit pAb
MBS8547822-01 0.1 mL

EIF2B3 Rabbit pAb

Sign In for Pricing
View Details
EIF2B3 Rabbit pAb
MBS8547822-02 0.1 mL (AF405L)

EIF2B3 Rabbit pAb

Sign In for Pricing
View Details