Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eve Rabbit Polyclonal Antibody (FITC)

Eve Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

10.5, 10.9, 14.10, 20.35, CG2328, dm-eve, Dmel\CG2328, E (eve), Eve, EVE, eve2, even, F, l (2) 46Ce, l (2) 46CFg, l (2) 46CFh, l (2) 46CFj, l (2) 46CFp, l (2) 46Cg, V, VI

UniProt

P06602

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Fruit fly

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MHGYRTYNMESHHAHHDASPVDQKPLVVDLLATQYGKPQTPPPSPNECLS

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_523670

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biglycan discontinued
507278 100 µg

Biglycan discontinued

Sign In for Pricing
View Details
Pig Cardiac Fibroblast Medium
ARM0909 500 mL

Pig Cardiac Fibroblast Medium

Sign In for Pricing
View Details
Mouse Ca-Mg-ATPase ELISA Kit
E109997 1 Each

Mouse Ca-Mg-ATPase ELISA Kit

Sign In for Pricing
View Details
CCNG2 Rabbit Polyclonal Antibody (BF594)
orb1573776 100 µL

CCNG2 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Recombinant Escherichia coli Transposase insH for insertion sequence element IS5H (insH6)
MBS1221569-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Transposase insH for insertion sequence element IS5H (insH6)

Sign In for Pricing
View Details
Recombinant Escherichia coli Transposase insH for insertion sequence element IS5H (insH6)
MBS1221569-02 0.02 mg (Yeast)

Recombinant Escherichia coli Transposase insH for insertion sequence element IS5H (insH6)

Sign In for Pricing
View Details