Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prd Rabbit Polyclonal Antibody (Biotin)

Prd Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CG6716, Dmel\CG6716, pr, Prd, PRD

UniProt

P06601

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Fruit fly

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MTVTAFAAAMHRPFFNGYSTMQDMNSGQGRVNQLGGVFINGRPLPNNIRL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_723721

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPNXB, ID (SPANXB1, SPANXB, Sperm protein associated with the nucleus on the X chromosome B/F, Cancer/testis antigen 11.2, Nuclear-associated protein SPAN-Xb, Nuclear-associated protein SPAN-Xf, SPANX family member B/F) (MaxLight 550)
MBS6350702-01 0.1 mL

SPNXB, ID (SPANXB1, SPANXB, Sperm protein associated with the nucleus on the X chromosome B/F, Cancer/testis antigen 11.2, Nuclear-associated protein SPAN-Xb, Nuclear-associated protein SPAN-Xf, SPANX family member B/F) (MaxLight 550)

Sign In for Pricing
View Details
SPNXB, ID (SPANXB1, SPANXB, Sperm protein associated with the nucleus on the X chromosome B/F, Cancer/testis antigen 11.2, Nuclear-associated protein SPAN-Xb, Nuclear-associated protein SPAN-Xf, SPANX family member B/F) (MaxLight 550)
MBS6350702-02 5x 0.1 mL

SPNXB, ID (SPANXB1, SPANXB, Sperm protein associated with the nucleus on the X chromosome B/F, Cancer/testis antigen 11.2, Nuclear-associated protein SPAN-Xb, Nuclear-associated protein SPAN-Xf, SPANX family member B/F) (MaxLight 550)

Sign In for Pricing
View Details
GlpE Antibody
orb816373 2 mg

GlpE Antibody

Sign In for Pricing
View Details
Ptk2 3'UTR Luciferase Stable Cell Line
TU217045 1.0 mL

Ptk2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PPM1F Blocking peptide
orb1443335 500 µg

PPM1F Blocking peptide

Sign In for Pricing
View Details
Influenza A H8N4 Hemagglutinin/HA Antibody, Rabbit PAb
MBS8105705-01 0.02 mL

Influenza A H8N4 Hemagglutinin/HA Antibody, Rabbit PAb

Sign In for Pricing
View Details