Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lab Rabbit Polyclonal Antibody (FITC)

Lab Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BG:DS00004.9, CG1264, Dm lab, Dmel\CG1264, Dmlab, DmLab, EfR9, F121, F24, F90, F90-2, l (3) 01241, l (3) 84Ac, Lab, LAB, lb

UniProt

P10105

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Fruit fly

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQL

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

CAA31495

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (3-Iodophenyl) cyclopropanol
407872-01 50 mg

1- (3-Iodophenyl) cyclopropanol

Sign In for Pricing
View Details
1- (3-Iodophenyl) cyclopropanol
407872-02 250 mg

1- (3-Iodophenyl) cyclopropanol

Sign In for Pricing
View Details
Recombinant Human N-acetylated-alpha-linked acidic dipeptidase 2 (NAALAD2), partial, Biotinylated
CSB-MP896715HU2-B-01 20 µg

Recombinant Human N-acetylated-alpha-linked acidic dipeptidase 2 (NAALAD2), partial, Biotinylated

Sign In for Pricing
View Details
Recombinant Human N-acetylated-alpha-linked acidic dipeptidase 2 (NAALAD2), partial, Biotinylated
CSB-MP896715HU2-B-02 100 µg

Recombinant Human N-acetylated-alpha-linked acidic dipeptidase 2 (NAALAD2), partial, Biotinylated

Sign In for Pricing
View Details
Recombinant Human N-acetylated-alpha-linked acidic dipeptidase 2 (NAALAD2), partial, Biotinylated
CSB-MP896715HU2-B-03 1 mg

Recombinant Human N-acetylated-alpha-linked acidic dipeptidase 2 (NAALAD2), partial, Biotinylated

Sign In for Pricing
View Details
Recombinant Drosophila bifasciata Cytochrome c oxidase subunit 2 (mt:CoII)
MBS7021346-01 0.02 mg

Recombinant Drosophila bifasciata Cytochrome c oxidase subunit 2 (mt:CoII)

Sign In for Pricing
View Details