Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pb Rabbit Polyclonal Antibody (HRP)

Pb Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BG:DS01719.1, CG17880, CG31481, Dmel\CG31481, Dmpb, l (3) 04498, Pb, PB, pd, pr

UniProt

P31264

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DLTERQVKVWFQNRRMKHKRQTLSKTDDEDNKDSLKGDDDQSDSNSNSKK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_996163

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PUMA (CT) Antibody: PerCP
MBS806706-01 0.1 mg

PUMA (CT) Antibody: PerCP

Sign In for Pricing
View Details
PUMA (CT) Antibody: PerCP
MBS806706-02 5x 0.1 mg

PUMA (CT) Antibody: PerCP

Sign In for Pricing
View Details
10% SDS (DNase, RNase & Protease free, Sterile)
ST629-100ml 100 mL

10% SDS (DNase, RNase & Protease free, Sterile)

Sign In for Pricing
View Details
MACROD2/C20orf133 Rabbit pAb, PE-Cy5 conjugated
orb2881879 100 µL

MACROD2/C20orf133 Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
Human CCR8 (Chemokine C-C-Motif Receptor 8) ELISA Kit
MBS2510025-01 24 Tests (Limit 1)

Human CCR8 (Chemokine C-C-Motif Receptor 8) ELISA Kit

Sign In for Pricing
View Details
Human CCR8 (Chemokine C-C-Motif Receptor 8) ELISA Kit
MBS2510025-02 48 Tests

Human CCR8 (Chemokine C-C-Motif Receptor 8) ELISA Kit

Sign In for Pricing
View Details