Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Antp Rabbit Polyclonal Antibody (HRP)

Antp Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

3.4, Ant, ANT-C, ANT-P, ANTC, antp, AntP, ANTP, Antp P1, Antp P2, Antp1, AntP1, Aus, BG:DS07700.1, CG1028, DmAntp, DMANTPE1, Dmel\CG1028, DRO15DC96Z, Hu, l (3) 84Ba, Ns, Scx

UniProt

P02833

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Fruit fly

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_996176

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-N. gonorrhoeae Antibody, IgG2b (MOFY-0922-FY266)
MOFY-0922-FY266 Each

Mouse Anti-N. gonorrhoeae Antibody, IgG2b (MOFY-0922-FY266)

Sign In for Pricing
View Details
GNGT1 (Guanine Nucleotide-Binding Protein G (T) Subunit gamma-T1, Transducin gamma Chain, GNGT1) (MaxLight 405) discontinued
302472-ML405 100 µL

GNGT1 (Guanine Nucleotide-Binding Protein G (T) Subunit gamma-T1, Transducin gamma Chain, GNGT1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Mouse Tcn2 Pre-designed siRNA Set A
SI114388A 1 Each

Mouse Tcn2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
KCTD15 Knockout HAP1 Polyclonal Cells
ARG27664 1 Million

KCTD15 Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details
MMP25 Protein Vector (Mouse) (pPM-C-HA)
PV201308 500 ng

MMP25 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
XCL2 Rabbit Polyclonal Antibody
orb214633-01 30 µL

XCL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details