Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLAC8 Rabbit Polyclonal Antibody (FITC)

PLAC8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C15, DGIC, onzin, PNAS-144

UniProt

Q9NZF1

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence AQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGC

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGC

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

13 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human

Tested Applications

IHC

NCBI Accession Number

NP_057703

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Induction Coil
1090720/A5 1 Each

Induction Coil

Sign In for Pricing
View Details
LIN28, phosphorylated (S134) (LIN28A, CSDD1, LIN28, ZCCHC1, Protein lin-28 homolog A, Zinc finger CCHC domain-containing protein 1) (MaxLight 650) discontinued
037792-ML650 100 µL

LIN28, phosphorylated (S134) (LIN28A, CSDD1, LIN28, ZCCHC1, Protein lin-28 homolog A, Zinc finger CCHC domain-containing protein 1) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Piracetam Impurity 33
RM-P180133-01 10 mg

Piracetam Impurity 33

Sign In for Pricing
View Details
Piracetam Impurity 33
RM-P180133-02 25 mg

Piracetam Impurity 33

Sign In for Pricing
View Details
Piracetam Impurity 33
RM-P180133-03 50 mg

Piracetam Impurity 33

Sign In for Pricing
View Details
Piracetam Impurity 33
RM-P180133-04 100 mg

Piracetam Impurity 33

Sign In for Pricing
View Details