Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLAC8 Rabbit Polyclonal Antibody (HRP)

PLAC8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C15, DGIC, onzin, PNAS-144

UniProt

Q9NZF1

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence AQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGC

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGC

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

13 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human

Tested Applications

IHC

NCBI Accession Number

NP_057703

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEPT12 Rabbit Polyclonal Antibody (FITC)
orb2108871 100 µL

SEPT12 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Anti-TSEN34 Antibody Picoband®, Dylight550 Conjugate
A12386-1-Dylight550 100 µg

Anti-TSEN34 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
ZFYVE1, NT (ZFYVE1, DFCP1, KIAA1589, TAFF1, ZNFN2A1, Zinc finger FYVE domain-containing protein 1, Double FYVE-containing protein 1, SR3, Tandem FYVE fingers-1) (Azide free) (HRP) discontinued
044077-HRP 200 µL

ZFYVE1, NT (ZFYVE1, DFCP1, KIAA1589, TAFF1, ZNFN2A1, Zinc finger FYVE domain-containing protein 1, Double FYVE-containing protein 1, SR3, Tandem FYVE fingers-1) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
IFT172 Protein Vector (Human) (pPB-N-His)
PV085510 500 ng

IFT172 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
L-Alanine 99% For Biochemistry
00088 00025 25 g

L-Alanine 99% For Biochemistry

Sign In for Pricing
View Details
ASGR1 Rabbit pAb
MBS8546406-01 0.1 mL

ASGR1 Rabbit pAb

Sign In for Pricing
View Details