Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fxn Rabbit Polyclonal Antibody (FITC)

Fxn Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FA, Fr, X25, FARR, Frda

UniProt

O35943

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032070

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Idh3g AAV siRNA Pooled Vector
24191166 1.0 µg

Idh3g AAV siRNA Pooled Vector

Sign In for Pricing
View Details
FBXO36 (F-Box Protein 36, FLJ37592, FLJ41090, Fbx36) (PE)
126691-PE 100 µL

FBXO36 (F-Box Protein 36, FLJ37592, FLJ41090, Fbx36) (PE)

Sign In for Pricing
View Details
Biotin Anti-Mouse CD40 Antibody[FGK4.5/FGK45]
E-AB-F1028B-01 25 µg

Biotin Anti-Mouse CD40 Antibody[FGK4.5/FGK45]

Sign In for Pricing
View Details
Biotin Anti-Mouse CD40 Antibody[FGK4.5/FGK45]
E-AB-F1028B-02 100 µg

Biotin Anti-Mouse CD40 Antibody[FGK4.5/FGK45]

Sign In for Pricing
View Details
Canine Nuclear factor NF-kappa-B p105 subunit, NFKB1 ELISA KIT
ELI-05882d 96 Tests

Canine Nuclear factor NF-kappa-B p105 subunit, NFKB1 ELISA KIT

Sign In for Pricing
View Details
THT-14-473-10 Pre-sized Labels for Printers
029907 10000 Roll (10000 Label (s) x 1 Roll)

THT-14-473-10 Pre-sized Labels for Printers

Sign In for Pricing
View Details