Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1R13B Rabbit Polyclonal Antibody (FITC)

PPP1R13B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P85, ASPP1, p53BP2-like

UniProt

Q96KQ4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PPP1R13B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EFDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

119kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_056131

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AACT Recombinant Rabbit mAb, APC-Cy7 conjugated
orb3001057 100 µL

AACT Recombinant Rabbit mAb, APC-Cy7 conjugated

Sign In for Pricing
View Details
Hsp70-GFP (RFP) Lentiviral particles
LVP863-R 1 x 10^7 IFU/mL - 200 µL

Hsp70-GFP (RFP) Lentiviral particles

Sign In for Pricing
View Details
EIF3M (Eukaryotic Translation Initiation Factor 3 Subunit M, B5, GA17, PCID1, TANGO7, hfl-B5) discontinued
210644-01 20 µL

EIF3M (Eukaryotic Translation Initiation Factor 3 Subunit M, B5, GA17, PCID1, TANGO7, hfl-B5) discontinued

Sign In for Pricing
View Details
EIF3M (Eukaryotic Translation Initiation Factor 3 Subunit M, B5, GA17, PCID1, TANGO7, hfl-B5) discontinued
210644-02 100 µL

EIF3M (Eukaryotic Translation Initiation Factor 3 Subunit M, B5, GA17, PCID1, TANGO7, hfl-B5) discontinued

Sign In for Pricing
View Details
Recombinant Arthroderma benhamiae ATPase synthesis protein 25, mitochondrial (ATP25), partial
MBS1083350 Inquire

Recombinant Arthroderma benhamiae ATPase synthesis protein 25, mitochondrial (ATP25), partial

Sign In for Pricing
View Details
Anti-Proinsulin, rat
orb1571530-01 1 mg

Anti-Proinsulin, rat

Sign In for Pricing
View Details