Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1R13B Rabbit Polyclonal Antibody (HRP)

PPP1R13B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P85, ASPP1, p53BP2-like

UniProt

Q96KQ4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PPP1R13B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EFDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

119kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_056131

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ECGF1 (Thymidine Phosphorylase, ECGF1, MNGIE, PDECGF, TP, hPD-ECGF)
245577 50 µL

ECGF1 (Thymidine Phosphorylase, ECGF1, MNGIE, PDECGF, TP, hPD-ECGF)

Sign In for Pricing
View Details
Anti-PD-ECGF TYMP Antibody
A06329 100 µL

Anti-PD-ECGF TYMP Antibody

Sign In for Pricing
View Details
SNORD29 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2226707 1.0 µg DNA

SNORD29 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Caspase-3 (4i29)
sc-56050 200 µg/mL

Caspase-3 (4i29)

Sign In for Pricing
View Details
Rat Cutaneous T-Cell Attracting Chemokine (CTACK) ELISA Kit
orb1949987-01 48 Tests

Rat Cutaneous T-Cell Attracting Chemokine (CTACK) ELISA Kit

Sign In for Pricing
View Details
Rat Cutaneous T-Cell Attracting Chemokine (CTACK) ELISA Kit
orb1949987-02 96 Tests

Rat Cutaneous T-Cell Attracting Chemokine (CTACK) ELISA Kit

Sign In for Pricing
View Details