Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPATA20 Rabbit Polyclonal Antibody (FITC)

SPATA20 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SSP411, Tisp78, HEL-S-98

UniProt

Q8TB22

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SPATA20

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GFYSAEDADSPPERGQRPKEGAYYVWTVKEVQQLLPEPVLGATEPLTSGQ

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ZKSCAN5 Antibody
A14633-2 100 µL

Anti-ZKSCAN5 Antibody

Sign In for Pricing
View Details
Canine Transmembrane and Coiled-Coil Domain-Containing Protein 6 (TMCO6) ELISA Kit
MBS9377972-01 48 Well

Canine Transmembrane and Coiled-Coil Domain-Containing Protein 6 (TMCO6) ELISA Kit

Sign In for Pricing
View Details
Canine Transmembrane and Coiled-Coil Domain-Containing Protein 6 (TMCO6) ELISA Kit
MBS9377972-02 96 Well

Canine Transmembrane and Coiled-Coil Domain-Containing Protein 6 (TMCO6) ELISA Kit

Sign In for Pricing
View Details
Canine Transmembrane and Coiled-Coil Domain-Containing Protein 6 (TMCO6) ELISA Kit
MBS9377972-03 5x 96 Well

Canine Transmembrane and Coiled-Coil Domain-Containing Protein 6 (TMCO6) ELISA Kit

Sign In for Pricing
View Details
Canine Transmembrane and Coiled-Coil Domain-Containing Protein 6 (TMCO6) ELISA Kit
MBS9377972-04 10x 96 Well

Canine Transmembrane and Coiled-Coil Domain-Containing Protein 6 (TMCO6) ELISA Kit

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Adenylosuccinate synthetase (purA)
MBS1474874-01 0.02 mg (E-Coli)

Recombinant Xylella fastidiosa Adenylosuccinate synthetase (purA)

Sign In for Pricing
View Details