Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPATA20 Rabbit Polyclonal Antibody (HRP)

SPATA20 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SSP411, Tisp78, HEL-S-98

UniProt

Q8TB22

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SPATA20

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GFYSAEDADSPPERGQRPKEGAYYVWTVKEVQQLLPEPVLGATEPLTSGQ

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RF/6A Cell Lines Complete Growth Medium 500ML
IRF6ACLCGM500ML 500 mL

RF/6A Cell Lines Complete Growth Medium 500ML

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Connective Tissue Growth Factor (CTGF)
MBS2105741-01 0.1 mL

HRP-Linked Monoclonal Antibody to Connective Tissue Growth Factor (CTGF)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Connective Tissue Growth Factor (CTGF)
MBS2105741-02 0.2 mL

HRP-Linked Monoclonal Antibody to Connective Tissue Growth Factor (CTGF)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Connective Tissue Growth Factor (CTGF)
MBS2105741-03 0.5 mL

HRP-Linked Monoclonal Antibody to Connective Tissue Growth Factor (CTGF)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Connective Tissue Growth Factor (CTGF)
MBS2105741-04 1 mL

HRP-Linked Monoclonal Antibody to Connective Tissue Growth Factor (CTGF)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Connective Tissue Growth Factor (CTGF)
MBS2105741-05 5 mL

HRP-Linked Monoclonal Antibody to Connective Tissue Growth Factor (CTGF)

Sign In for Pricing
View Details