Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NANOG Rabbit Polyclonal Antibody (Biotin)

NANOG Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9H9S0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NANOG

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ESSLTPVTCGPEENYPSLQMSSAEMPHAETVSPLPSSMDLLIQDSPDSST

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Porcine, Sheep

Tested Applications

WB

NCBI Accession Number

NP_079141

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C21orf110 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
53734111 3x 1.0 µg

C21orf110 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
FAM71F1 Adenovirus (Mouse)
20097054 1.0 mL

FAM71F1 Adenovirus (Mouse)

Sign In for Pricing
View Details
Lentiviral human VAMP4 sgRNA gene knockout kit - Lentiviral human VAMP4 sgRNA gene knockout kit (plasmid)
GTR15368231 1 Vial

Lentiviral human VAMP4 sgRNA gene knockout kit - Lentiviral human VAMP4 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
DENN Polyclonal Antibody, HRP Conjugated
bs-14268R-HRP 100 µL

DENN Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
UTY Antibody - N-terminal region (ARP33486_P050)
ARP33486_P050 100 µL

UTY Antibody - N-terminal region (ARP33486_P050)

Sign In for Pricing
View Details
Mouse Mrpl2 qPCR Primer Pair
QM25282S 200 Tests

Mouse Mrpl2 qPCR Primer Pair

Sign In for Pricing
View Details