Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPATA46 Rabbit Polyclonal Antibody (FITC)

SPATA46 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HSD20, C1orf111

UniProt

Q5T0L3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C1orf111

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CKVYYRKLKALWSKEQKARLGDRLSSGSCQAFNSPAEHLRQIGGEAYLCL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_872387

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG12 Antibody
ABD8180 100 µg

ATG12 Antibody

Sign In for Pricing
View Details
Mouse Foxd3 Pre-designed siRNA Set A
SI105043A 1 Each

Mouse Foxd3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Acetylleucine
BUP19151 1 Each

Acetylleucine

Sign In for Pricing
View Details
mmu-miR-5124a miRNA Inhibitor
MIM02242 2x 5.0 nmol

mmu-miR-5124a miRNA Inhibitor

Sign In for Pricing
View Details
MARCH1 (E3 Ubiquitin-protein Ligase MARCH1, Membrane-associated RING Finger Protein 1, Membrane-associated RING-CH Protein I, MARCH-I, RING Finger Protein 171, RNF171, DKFZp564M1682, FLJ20668) (MaxLight 405)
MBS6191085-01 0.1 mL

MARCH1 (E3 Ubiquitin-protein Ligase MARCH1, Membrane-associated RING Finger Protein 1, Membrane-associated RING-CH Protein I, MARCH-I, RING Finger Protein 171, RNF171, DKFZp564M1682, FLJ20668) (MaxLight 405)

Sign In for Pricing
View Details
MARCH1 (E3 Ubiquitin-protein Ligase MARCH1, Membrane-associated RING Finger Protein 1, Membrane-associated RING-CH Protein I, MARCH-I, RING Finger Protein 171, RNF171, DKFZp564M1682, FLJ20668) (MaxLight 405)
MBS6191085-02 5x 0.1 mL

MARCH1 (E3 Ubiquitin-protein Ligase MARCH1, Membrane-associated RING Finger Protein 1, Membrane-associated RING-CH Protein I, MARCH-I, RING Finger Protein 171, RNF171, DKFZp564M1682, FLJ20668) (MaxLight 405)

Sign In for Pricing
View Details