Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK1 Rabbit Polyclonal Antibody (HRP)

DKK1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SK, DKK-1

UniProt

O94907

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DKK1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036374

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H16703-0000, Screen basket, HDPE
1213927 1 Unit

H16703-0000, Screen basket, HDPE

Sign In for Pricing
View Details
KCNJ9 CRISPRa sgRNA lentivector (set of three targets)(Rat)
25390126 3x 1.0µg DNA

KCNJ9 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
RELT sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1808305 3x 1.0 µg

RELT sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Human UBQLN1 / Ubiquilin-1 Recombinant Protein
MBS2903620 Inquire

Human UBQLN1 / Ubiquilin-1 Recombinant Protein

Sign In for Pricing
View Details
HSF2 Overexpression Lysate (Native) - (Dry Ice)
NBL1-11737 0.1 mg

HSF2 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Biglycan (BGN) (NM_001711) Human Tagged ORF Clone Lentiviral Particle
RC200715L1V 200 µL

Biglycan (BGN) (NM_001711) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details