Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG-2, Mouse (HEK293, His)

REG-2 Protein potentially inhibits spontaneous calcium carbonate precipitation. REG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-2 protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

REG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg2-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

QVAEEDFPLAEKDLPSAKINCPEGANAYGSYCYYLIEDRLTWGEADLFCQNMNAGHLVSILSQAESNFVASLVKESGTTASNVWTGLHDPKSNRRWHWSSGSLFLFKSWATGAPSTANRGYCVSLTSNTAYKKWKDENCEAQYSFVCKFRA

Molecular Formula

19693 (Gene_ID) Q08731 (Q23-A173) (Accession)

Molecular Weight

Approximately 16.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spermidine-d6 Trihydrochloride
TRC-S680407-1MG 1 mg

Spermidine-d6 Trihydrochloride

Sign In for Pricing
View Details
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2743), CF405S conjugate, 0.1mg/mL
BNC042743-100 1x 100 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2743), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD4 Antibody[RPA-T4]
E-AB-F1109M-01 20 Tests

Elab Fluor® 647 Anti-Human CD4 Antibody[RPA-T4]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD4 Antibody[RPA-T4]
E-AB-F1109M-02 100 Tests

Elab Fluor® 647 Anti-Human CD4 Antibody[RPA-T4]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD4 Antibody[RPA-T4]
E-AB-F1109M-03 2x 100 Tests

Elab Fluor® 647 Anti-Human CD4 Antibody[RPA-T4]

Sign In for Pricing
View Details
SSBP1 Human Gene Knockout Kit (CRISPR)
KN415106 1 Kit

SSBP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details