Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REC8 Rabbit Polyclonal Antibody (FITC)

REC8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Rec8p, REC8L1, HR21spB

UniProt

O95072

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human REC8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QLQIGVIRVYSQQCQYLVEDIQHILERLHRAQLQIRIDMETELPSLLLPN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_005123

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prpf31 3'UTR Luciferase Stable Cell Line
TU117036 1.0 mL

Prpf31 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Kelch domain-containing protein 10 (KLHDC10) Mouse ELISA Kit
E4793 96 Tests

Kelch domain-containing protein 10 (KLHDC10) Mouse ELISA Kit

Sign In for Pricing
View Details
Lentiviral human TOP1MT shRNA (UAS) - Lentiviral human TOP1MT shRNA (UAS, iRFP) plasmid
GTR15332623 1 Vial

Lentiviral human TOP1MT shRNA (UAS) - Lentiviral human TOP1MT shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Lentiviral human GRHL1 shRNA (UAS) - Lentiviral human GRHL1 shRNA (UAS, RFP) (100)
GTR15331539 1 Vial

Lentiviral human GRHL1 shRNA (UAS) - Lentiviral human GRHL1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
hsa-let-7b-3p miRNA Inhibitor
MBS8293266-01 10 nmol

hsa-let-7b-3p miRNA Inhibitor

Sign In for Pricing
View Details
hsa-let-7b-3p miRNA Inhibitor
MBS8293266-02 20 nmol

hsa-let-7b-3p miRNA Inhibitor

Sign In for Pricing
View Details