Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REC8 Rabbit Polyclonal Antibody (HRP)

REC8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Rec8p, REC8L1, HR21spB

UniProt

O95072

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human REC8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QLQIGVIRVYSQQCQYLVEDIQHILERLHRAQLQIRIDMETELPSLLLPN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_005123

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNM1 3'UTR GFP Stable Cell Line
TU056184 1.0 mL

DNM1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Bovine DNA- (apurinic or apyrimidinic site) lyase, APEX2 ELISA Kit
MBS9334022-01 48 Well

Bovine DNA- (apurinic or apyrimidinic site) lyase, APEX2 ELISA Kit

Sign In for Pricing
View Details
Bovine DNA- (apurinic or apyrimidinic site) lyase, APEX2 ELISA Kit
MBS9334022-02 96 Well

Bovine DNA- (apurinic or apyrimidinic site) lyase, APEX2 ELISA Kit

Sign In for Pricing
View Details
Bovine DNA- (apurinic or apyrimidinic site) lyase, APEX2 ELISA Kit
MBS9334022-03 5x 96 Well

Bovine DNA- (apurinic or apyrimidinic site) lyase, APEX2 ELISA Kit

Sign In for Pricing
View Details
Bovine DNA- (apurinic or apyrimidinic site) lyase, APEX2 ELISA Kit
MBS9334022-04 10x 96 Well

Bovine DNA- (apurinic or apyrimidinic site) lyase, APEX2 ELISA Kit

Sign In for Pricing
View Details
Mouse M2-Cholinergic Receptor Antibodies ELISA Kit
MBS043253-01 48 Well

Mouse M2-Cholinergic Receptor Antibodies ELISA Kit

Sign In for Pricing
View Details