Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tnni3k Rabbit Polyclonal Antibody (HRP)

Tnni3k Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ca, Cark, D830019J24Rik

UniProt

B2RTJ7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NLVACDPSRSSGEKDEQTCLMWAYEKGHDAIVTLLKHYKRPQDELPCNEY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

92kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_796040

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL24 (NM_006850) Human Recombinant Protein
TP316502L 1 mg

IL24 (NM_006850) Human Recombinant Protein

Sign In for Pricing
View Details
NSBP1 (HMGN5) Human Gene Knockout Kit (CRISPR)
KN402766 1 Kit

NSBP1 (HMGN5) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KAT3A / CBP (CREBBP) Human Gene Knockout Kit (CRISPR)
KN216439 1 Kit

KAT3A / CBP (CREBBP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ndufb11b Mouse Gene Knockout Kit (CRISPR)
KN500131 1 Kit

Ndufb11b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Abiraterone Isopropyl Ether
TRC-A108530-10MG 10 mg

Abiraterone Isopropyl Ether

Sign In for Pricing
View Details
BMP6 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8B11]
TA812215AM 100 µL

BMP6 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8B11]

Sign In for Pricing
View Details