Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YWHAZ Rabbit Polyclonal Antibody (HRP)

YWHAZ Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HEL4, YWHAD, KCIP-1, HEL-S-3, POPCHAS, HEL-S-93, 14-3-3-zeta

UniProt

P63104

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human YWHAZ

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGE

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_003397

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMG20B Antibody
8C11798-AAT 50 µg

HMG20B Antibody

Sign In for Pricing
View Details
L1CAM (NM_000425) Human Recombinant Protein
TP311601 20 µg

L1CAM (NM_000425) Human Recombinant Protein

Sign In for Pricing
View Details
SCmL1 (NM_001037540) Human Over-expression Lysate
LY421922 100 µg

SCmL1 (NM_001037540) Human Over-expression Lysate

Sign In for Pricing
View Details
CD11a (ITGAL) Mouse Monoclonal Antibody [Clone ID: CRIS-3]
AM50204PU-T 20 µg

CD11a (ITGAL) Mouse Monoclonal Antibody [Clone ID: CRIS-3]

Sign In for Pricing
View Details
Mouse Dnase2a activation kit by CRISPRa
GA201101 1 Kit

Mouse Dnase2a activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS702025 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details