Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E130311K13Rik Rabbit Polyclonal Antibody (Biotin)

E130311K13Rik Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: STGMAIAGIMLLIRSVRLTSKFTTSSDIPVEFIRKKVKLRGRLQRITECG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_002725693

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPMI-1640 Mycoplasma Removal Medium
abx704790 100 mL

RPMI-1640 Mycoplasma Removal Medium

Sign In for Pricing
View Details
Duck Calpain 9 (CAPN9) ELISA Kit
MBS9902880 Inquire

Duck Calpain 9 (CAPN9) ELISA Kit

Sign In for Pricing
View Details
TMEM74 Rabbit pAb, AP conjugated
orb2863435 100 µL

TMEM74 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
ATP5MC2 Antibody - N-terminal region
ARP40228_P050-25UL 25 µL

ATP5MC2 Antibody - N-terminal region

Sign In for Pricing
View Details
IACS-010759 (IACS-10759)
C13625-01 5 mg

IACS-010759 (IACS-10759)

Sign In for Pricing
View Details
IACS-010759 (IACS-10759)
C13625-02 10 mM / 1 mL

IACS-010759 (IACS-10759)

Sign In for Pricing
View Details