Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E130311K13Rik Rabbit Polyclonal Antibody (Biotin)

E130311K13Rik Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: STGMAIAGIMLLIRSVRLTSKFTTSSDIPVEFIRKKVKLRGRLQRITECG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_002725693

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Weighing Machine, Digital
2011845/1 1 Each

Weighing Machine, Digital

Sign In for Pricing
View Details
HYOU1 (GRP170, ORP150, Hypoxia Up-regulated Protein 1, 150kD Oxygen-regulated Protein, 170kD Glucose-regulated Protein) (MaxLight 405)
MBS6190651-01 0.1 mL

HYOU1 (GRP170, ORP150, Hypoxia Up-regulated Protein 1, 150kD Oxygen-regulated Protein, 170kD Glucose-regulated Protein) (MaxLight 405)

Sign In for Pricing
View Details
HYOU1 (GRP170, ORP150, Hypoxia Up-regulated Protein 1, 150kD Oxygen-regulated Protein, 170kD Glucose-regulated Protein) (MaxLight 405)
MBS6190651-02 5x 0.1 mL

HYOU1 (GRP170, ORP150, Hypoxia Up-regulated Protein 1, 150kD Oxygen-regulated Protein, 170kD Glucose-regulated Protein) (MaxLight 405)

Sign In for Pricing
View Details
His-Tag (Poly-His, hexa-HIS, hexa-Histidine) (Biotin)
MBS6306650-01 0.2 mL

His-Tag (Poly-His, hexa-HIS, hexa-Histidine) (Biotin)

Sign In for Pricing
View Details
His-Tag (Poly-His, hexa-HIS, hexa-Histidine) (Biotin)
MBS6306650-02 5x 0.2 mL

His-Tag (Poly-His, hexa-HIS, hexa-Histidine) (Biotin)

Sign In for Pricing
View Details
Anti-Human CD20 Monoclonal Antibody (PerCP Conjugated)
MBS2558331-01 20 Tests

Anti-Human CD20 Monoclonal Antibody (PerCP Conjugated)

Sign In for Pricing
View Details