Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL28RA Rabbit Polyclonal Antibody (HRP)

IL28RA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IFNLR, LICR2, IL28RA, CRF2/12, IL-28R1

UniProt

Q5VTX8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human IL28RA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_775087

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mast3 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6214403 1.0 µg DNA

Mast3 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
EOLA1 Lentiviral Activation Particles (h)
sc-417224-LAC 200 µL

EOLA1 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Anti-Human CD53 Monoclonal Antibody (PerCP Conjugated)
MBS4516637-01 20 Tests

Anti-Human CD53 Monoclonal Antibody (PerCP Conjugated)

Sign In for Pricing
View Details
Anti-Human CD53 Monoclonal Antibody (PerCP Conjugated)
MBS4516637-02 50 Tests

Anti-Human CD53 Monoclonal Antibody (PerCP Conjugated)

Sign In for Pricing
View Details
Anti-Human CD53 Monoclonal Antibody (PerCP Conjugated)
MBS4516637-03 100 Tests

Anti-Human CD53 Monoclonal Antibody (PerCP Conjugated)

Sign In for Pricing
View Details
Anti-Human CD53 Monoclonal Antibody (PerCP Conjugated)
MBS4516637-04 5x 100 Tests

Anti-Human CD53 Monoclonal Antibody (PerCP Conjugated)

Sign In for Pricing
View Details